Atenção médicos que alugam seus CRMs!!! Em São Paulo, 50 estão presos por esse tipo de fraude

Publicado em   21/jun/2011
por  Caio Hostilio

Pode chegar a 50 o número de envolvidos no esquema de fraudes no sistema público de saúde do Estado de São Paulo investigado pela Operação Hipócrates. De acordo com o Ministério Público Estadual (MP-SP), testemunhas e pacientes estão se apresentado espontaneamente para fazer novas denúncias relacionadas aos crimes sob investigação.

Promotores de Sorocaba pediram nesta segunda-feira, 20, a prorrogação da prisão temporária de oito suspeitos que continuam presos no batalhão da Polícia Militar (PM). O esquema teria desviado pelo menos R$ 2 milhões de recursos da saúde recebendo por plantões médicos que nunca foram dados.

Em entrevista conjunta com os delegados Wilson Negrão e Rodrigo Ayres, da Polícia Civil de Sorocaba, os promotores Claudio Bonadia de Souza e Maria Aparecida Castanho confirmaram indícios de envolvimento, no esquema, do ex-secretário de Esporte, Lazer e Juventude do Estado, Jorge Pagura. O ex-secretário, que deixou o cargo após a denúncia, será investigado pela Procuradoria-Geral de Justiça do Estado, órgão máximo do Ministério Público. ‘Vamos encaminhar as peças do inquérito ao procurador-geral (Fernando Grella Vieira), pois ele é que tem a atribuição de investigar um secretário de Estado’, disse a promotora.

Já o ex-coordenador de Serviços de Saúde da Secretaria da Saúde do Estado de São Paulo, Ricardo Tardelli, será intimado para prestar depoimento em Sorocaba ainda esta semana. Ele pediu demissão nesta segunda-feira, depois de ter seu nome vinculado à investigação das fraudes. Em nota, Tardelli negou envolvimento, mas afirmou ter tomado a decisão de sair para garantir transparência nas investigações.

De acordo com a promotora, testemunhas e pacientes do Conjunto Hospitalar de Sorocaba (CHS), foco principal do esquema, estão comparecendo espontaneamente para contribuir com a investigação. Pelo menos 30 pessoas já foram ouvidas. ‘Nesta primeira fase, pegamos os principais articuladores e, na sequência, vamos atrás dos que se beneficiaram com a fraude’, disse. O trabalho de apuração não tem prazo para terminar e será retroativo apenas aos últimos três anos. Segundo a promotora, além dos plantões fantasmas, há indícios de irregularidades em compras e serviços. ‘Todos serão investigados pela prática de crimes que vão de desvio de dinheiro público a falsificação e formação de quadrilha.’

Das 13 pessoas que tiveram a prisão decretada, entre elas seis médicos, dois dentistas, uma enfermeira e dois empresários, quatro foram libertadas, três delas por colaborar com a investigação. O ex-diretor do CHS, Heitor Consani, foi solto mediante habeas corpus concedido pelo Tribunal de Justiça (TJ) de São Paulo, mas os promotores voltaram a pedir sua prisão e aguardavam a decisão. De acordo com Souza, ele é peça-chave no inquérito e uma possível fuga do médico pode prejudicar as investigações.

A polícia continua à procura da dentista Tânia Maris de Paiva, a única dos investigados que está foragida.

Com informação do Estadão.

  Publicado em: Governo

86 comentários para Atenção médicos que alugam seus CRMs!!! Em São Paulo, 50 estão presos por esse tipo de fraude

  1. aluisio disse:

    o pior foi o prefeito de barreirinhas q contratou um medico sem CRM, KAIO PATRICIO, como pode? kd a PF? o ministerio publico?

  2. CHIGA PORTUGAL disse:

    CHICO GOMES É UM ADMINISTRADOR QUE TRABALHA COM AMOR, POLITICO COM REPEITO AS CAUSAS PUBLICAS.
    O GOVERNO SABE QUE PODE CONTAR COM ESTE HOMEM.POIS MUINTA FALTA TEM O MESMO FEITO NA BANCADA GOVERNISTA DA ASSEMBLEIA LEGISLATIVA DO MARANÃO.

  3. Hey, this is the great site. Im forever searching for sites resembling this. Continue on the good effort!

  4. Im not capable of view this website properly on opera I feel there is a problem

  5. As i originally commented I clicked the -Notify me when new surveys are added- checkbox and today if a remark is added I buy 4 emails using the same comment. Is there any method you can easlily remove me from that service? Thanks!

  6. You have mentioned very interesting details ! ps nice internet site .

  7. I adore your blog site and that i respect your writing. I’ll be a frequent visitor definitely! How do i enroll in RSS?

  8. make beats disse:

    I will be chatting with permit you to be familiar with such a really good encounter our daughter experienced viewing your blog. She came to find numerous pieces, including what its like to have an incredible teaching mood to obtain some people really easily understand that a number of problematic intended theme. You undoubtedly exceeded readers expectations. I appreciate you for distributing these good, trusted, explanatory and also unique just what it your topic to Janet.

  9. hot games disse:

    Nice content you have for your internet site, any suggestions?

  10. I picture this may well be diverse upon the written content? however I nonetheless believe that it may be suitable for nearly any type of matter subject matter, as a result of it would often be gratifying to determine a heat and pleasant face or possibly listen a voice whilst preliminary landing.

  11. Today, while I was at work, my cousin stole my iphone and tested to see if it can survive a twenty five foot drop, just so she can be a youtube sensation. My iPad is now destroyed and she has 83 views. I know this is entirely off topic but I had to share it with someone!

  12. hotel towels disse:

    I’m speechless. It is a superb weblog and very enticing too. Great work! That’s not really much coming from an beginner writer like me, but it surely’s all I may just say after diving into your posts. Nice grammar and vocabulary. No longer like other blogs. You truly realize what you?re talking approximately too. Such a lot that you made me want to discover more. Your weblog has turn into a stepping stone for me, my friend.

  13. Nice! Just wanted to respond. I thoroughly loved your post. Keep up the great work.

  14. Very interesting info !Perfect just what I was searching for! debt relief

  15. Hey There. I found your blogdebt relief the use of msn. That is a really smartly written article. I’ll make sure to bookmark it and come back to learn more of your useful info. Thank you for the post. I will definitely comeback.

  16. Its such as you read mycomedian thoughts! Ydebt reliefou appear to know a lot approximately this, such as you wrote the e-book in it or something. I feel that you can do with some % to force the message home a little bit, however instead of that, this is great blog. An excellent read. I’ll definitely be back.

  17. comedian Absolutely indited debt relief subject matter, appreciate it for information .

  18. octfkvsmtlicakpcnreqdthkdhvnnmqsk

  19. I like this post a good deal. I will definitely be back. Hope i are able to continue reading helpful posts then. Will be sharing your knowledge wonderful my associates!

  20. This is getting a bit more subjective, but I much prefer the Zune Marketplace. The interface is colorful, has more flair, and some cool features like ‘Mixview’ that let you quickly see related albums, songs, or other users related to what you’re listening to. Clicking on one of those will center on that item, and another set of “neighbors” will come into view, allowing you to navigate around exploring by similar artists, songs, or users. Speaking of users, the Zune “Social” is also great fun, letting you find others with shared tastes and becoming friends with them. You then can listen to a playlist created based on an amalgamation of what all your friends are listening to, which is also enjoyable. Those concerned with privacy will be relieved to know you can prevent the public from seeing your personal listening habits if you so choose.

  21. A guy who’s going to be his personal lawyer contains a fool for his client

  22. Some comedianreally quality content on this debt relief internet site , bookmarked .

  23. I’ll gear this review to 2 types of people: current Zune owners who are considering an upgrade, and people trying to decide between a Zune and an iPod. (There are other players worth considering out there, like the Sony Walkman X, but I hope this gives you enough info to make an informed decision of the Zune vs players other than the iPod line as well.)

  24. debt relief disse:

    We’re a bunch comedianof volunteers and starting a brand new scheme in our community. Your site provided us with helpful information to paintings on. You’ve performed an impressive task and our whole neighborhood might be grateful to you.

  25. Fantastic comment I have, you put major time and energy engrossed Let me tell! Your overall web page is absolutely wonderful as well. How long would it just take yourself to create this fabulous site up to the place it really is in the present day?

  26. Hello, i believecomedian that i noticed yodebt reliefu visited my blog so i came to “return the prefer”.I’m attempting to find issues to enhance my web site!I suppose its good enough to use a few of your concepts!!

  27. The Zune concentrates on being a Portable Media Player. Not a web browser. Not a game machine. Maybe in the future it’ll do even better in those areas, but for now it’s a fantastic way to organize and listen to your music and videos, and is without peer in that regard. The iPod’s strengths are its web browsing and apps. If those sound more compelling, perhaps it is your best choice.

  28. QuickBooks disse:

    Hi! There are actually certainly a lot of details that way take into consideration. This is a great examine mention. I provide you with the thoughts above as general inspiration but clearly you can find questions such as the one you start up where most essential thing will probably be in honest good faith. I don?t know if best practices have emerged around items like that, however am certain that that a job is clearly referred to as a large game. Both girls and boys feel the impact of a moment’s pleasure, throughout their lives.

  29. SVCreation disse:

    How’s it that just you can write your blog to get as known as this? Its in contrast to youve said something inspiring much more youve painted a quite picture above an element that you understand nothing about! I dont want to sound mean, here. But don’t you actually reckon that you can get away with adding some quite pictures rather than truly say something?

  30. I’ve been searching on the web locate some ideas on how you can get my site coded, your overall design together with style remarkable. Did you code it by yourself or did you recruit a coder to get it done for you?

  31. I’ve been gone for some time, but now I remember why I used to love this website. Thanks, I’ll try and check back more often. How often do you update your website?

  32. Gday, i simply thought id comment and let you know your weblogs format. Seems like to appear excellent within the Google Chrome browser. Anyhow take care of the great work.

  33. I have seen lots of useful elements on your site Caio Hostilio about pc’s. However, I’ve got the view that netbooks are still less than powerful more than enough to be a wise decision if you typically do projects that require a great deal of power, such as video touch-ups. But for internet surfing, microsoft word processing, and many other frequent computer functions they are fine, provided you cannot mind the small screen size. Appreciate sharing your ideas.

  34. directory disse:

    Give your website a boost on this free web directory

  35. And exactly how the storyplot unfolds gradually racking up the stress yet still time treading on that fine line between dark and light-weight, good and evil, is only amazing how that has been designed in relation to its sentimentality Ripley ,missed her daughters birthday because fate was cruel to her in the circumstances of her floating out into space for 57 years, after she escaped in the Nostramo.

  36. Thank you for making the sincere attempt to talk about this. I feel very sturdy approximately it and want to learn more. If it’s OK, as you achieve extra in depth knowledge, could you mind adding extra articles very similar to this one with additional info? It might be extremely helpful and useful for me and my friends.

  37. windows games disse:

    Youre so cool! I dont suppose Ive read such as this before. So nice to find somebody with many authentic applying for grants this subject. realy thanks for starting this up. this site can be something that’s needed on the net, somebody after some bit originality. helpful work for bringing something totally new towards the web!

  38. “I’ve gone ahead and bookmarked http://caiohostilio.com/?p=4937 at Digg.com so my friends can see it too. I simply used Caio Hostilio as the entry title in my Digg.com bookmark, as I figured if it is good enough for you to title your blog post that, then you probably would like to see it bookmarked the same way

  39. I didnt see the concluding element of your article, do you please explain it more?

  40. ACN disse:

    wohh just the thing I was looking! , thankyou for the fantastic medical care peaks .

  41. Howdy sir, you have a very nice blog layout ??

  42. test#2 disse:

    Great stuff from you, man. Ive read your stuff before and youre just too fantastic. I love what youve got here, love what youre saying and the way you say it. You make it entertaining and you still manage to keep it smart. I cant wait to read more from you. This is really a great website.

  43. Simply desire to comediansay your article is adebt reliefs astonishing. The clearness for your submit is simply cool and i can think you’re a professional in this subject. Well with your permission let me to snatch your RSS feed to stay up to date with imminent post. Thank you one million and please carry on the enjoyable work.

  44. Freebies disse:

    Hello there. I’ve favorited this artecle so I can check it out later. I aplogize if this looks dumb but I was hoping anyone could show me how to add this article to my dekstop. Anyway, ty again!!

  45. I managed to get what we intend, saved to fav, very decent web site .

  46. My sister saved this web-site for me and I have already been encountering it over the past several hrs. This is definitely visiting benefit me and my classmates for class project. Mind you, I prefer and the choice of write.

  47. This is really interesting. Thanks for posting it. By the looks of the comments, many others think so too.

  48. Emmett Adrien disse:

    I simply want to tell you that I am newbie to blogging and truly liked you’re website. Most likely I’m want to bookmark your site . You surely have fabulous article content. Kudos for revealing your website page.

  49. You’d probably never ever find out these text via Barack Obama, due to the fact President obama is undoubtedly an ideologue, not much of a philosopher. Obama’s progressive ideology is definitely attached in a deep-rooted craze towards individuals who have great results through free of charge promotes as well as a deep-rooted consideration to those that realize success by way of group business and also marketplace confrontation.

  50. Texas Hold'em disse:

    Between me and my husband we’ve owned more MP3 players over the years than I can count, including Sansas, iRivers, iPods (classic & touch), the Ibiza Rhapsody, etc. But, the last few years I’ve settled down to one line of players. Why? Because I was happy to discover how well-designed and fun to use the underappreciated (and widely mocked) Zunes are.

  51. sizegenetics disse:

    You could certainly see your expertise in the paintings you write. The arena hopes for more passionate writers such as you who aren’t afraid to say how they believe. At all times go after your heart. “He never is alone that is accompanied with noble thoughts.” by Fletcher.

  52. Between me and my husband we’ve owned more MP3 players over the years than I can count, including Sansas, iRivers, iPods (classic & touch), the Ibiza Rhapsody, etc. But, the last few years I’ve settled down to one line of players. Why? Because I was happy to discover how well-designed and fun to use the underappreciated (and widely mocked) Zunes are.

  53. wonderful post, very informative. I ponder why the opposite experts of this sector don’t notice this. You should continue your writing. I’m sure, you have a great readers’ base already!

  54. You would never find out those text by Barack Obama, because Obama is surely an ideologue, not only a philosopher. Obama’s progressive ideological background will be secured within a deep-rooted trend against people who have great results as a result of free markets and also a deep-rooted consideration towards people that be successful as a result of area business and also marketplace confrontation.

  55. vimax pills disse:

    Great write-up, I am normal visitor of one’s web site, maintain up the excellent operate, and It is going to be a regular visitor for a lengthy time.

  56. This is getting a bit more subjective, but I much prefer the Zune Marketplace. The interface is colorful, has more flair, and some cool features like ‘Mixview’ that let you quickly see related albums, songs, or other users related to what you’re listening to. Clicking on one of those will center on that item, and another set of “neighbors” will come into view, allowing you to navigate around exploring by similar artists, songs, or users. Speaking of users, the Zune “Social” is also great fun, letting you find others with shared tastes and becoming friends with them. You then can listen to a playlist created based on an amalgamation of what all your friends are listening to, which is also enjoyable. Those concerned with privacy will be relieved to know you can prevent the public from seeing your personal listening habits if you so choose.

  57. Ford disse:

    Hiya, I’m really glad I have found this information. Today bloggers publish only about gossips and internet and this is really irritating. A good web site with interesting content, that is what I need. Thank you for keeping this web-site, I’ll be visiting it. Do you do newsletters? Can’t find it.

  58. A semen fluid volume analysis examines certain characteristics of a males semen fluid volume as well as sperm contained in the semen volume. It can be done while investigating a couples infertility problems or perhaps after the vasectomy to ensure that the task ended successful. It is also used by testing the majority of the donors for semen donation. During the last number of years you are able to produce more ejaculation fluid with absolutely natural ways like taking natural pills on the various Internet stores. Ejaculation liquid is definitely the measurement of sperm concentration of sperms in a very mans ejaculate. Various factors are evaluated that can help look at the sperm fertility of any every man much like the actual time period between ejaculations, semen sample analysis, how a sample is kept when being transported to your lab. Pills to get more semen liquid is trully great 100% herbal mix that should hugely enhance the level of ejaculate volume liquid by at least 300 percent. The amazingly well-known herbal tablet has a number of native South African vitamins, herbal and minerals.

  59. Get two plants, and set both of them in two different locations. One plant should be put in a box with a light so it can grow. The other plant should be put in a dark box so it will not grow.

  60. Podryw dziewczyn to dosc prosta sprawa. Aby rozkochac dziewczyne powinno umiec uwodzic. To banalne gdy wie sie o podrywaniu. Najlepsza ebook o tym jak byc atrakcyjnym to Sekrety Randek Internetowych.
    Metody podrywania dziewczyn pomoga Ci jak oczarowac prawie kazda dziewczyne.

  61. It has for being amongst my personal posts!

  62. I have to express some appreciation to the writer just for rescuing me from such a instance. Right after searching through the search engines and coming across solutions that were not beneficial, I was thinking my entire life was done. Living without the presence of strategies to the issues you’ve solved by way of your blog post is a serious case, as well as the kind that would have badly damaged my entire career if I hadn’t discovered your blog post. Your personal natural talent and kindness in playing with every part was useful. I am not sure what I would’ve done if I had not come upon such a step like this. I am able to at this moment look forward to my future. Thanks for your time very much for your skilled and effective help. I won’t hesitate to suggest your web page to anybody who needs to have support on this area.

  63. you’ve got a excellent weblog right here! would you like to have request articles on my personal blog?

  64. Zune and iPod: Most people compare the Zune to the Touch, but after seeing how slim and surprisingly small and light it is, I consider it to be a rather unique hybrid that combines qualities of both the Touch and the Nano. It’s very colorful and lovely OLED screen is slightly smaller than the touch screen, but the player itself feels quite a bit smaller and lighter. It weighs about 2/3 as much, and is noticeably smaller in width and height, while being just a hair thicker.

  65. EDU BACKLINKS disse:

    .edu backlinks happen to be a lot more powerful power one way links. These types of inbound links tend to be extremely explored by numerous internet marketers around the world since it is having a lot more authority and power compared to other frequent backlinks. Edu domains tend to be regarded as extremely by yahoo and google and also backlinks coming from .edu domains are usually several times more useful when compared with typical types.Yet precisely what about Edu’s? No person can acquire edu domains other than of educational institutions. And that’s exactly why they have the largest trust from Yahoo and google.Yahoo considers that EDU web site wouldn’t link to a web site with low-informational articles or perhaps articles this is not really worth Google’s attention. Possibly someone may say that anyone can acquire edu back links by just registering edu domain, but that is far from the truth. Due to the fact no person can purchase edu site apart from of educational facilities.To be certain you can attempt and apply for edu website.

  66. Thank you for the good writeup. It in fact was a amusement account it. Look advanced to more added agreeable from you! However, how could we communicate?

  67. Bookstore disse:

    Useful information. Fortunate me I discovered your site unintentionally, and I’m surprised why this accident didn’t took place in advance! I bookmarked it.

  68. You clearly know your stuff. Wish I could think of something clever to write here. Thanks for sharing.

  69. PeggyS disse:

    Great stuff from you, man. Ive read your stuff before and youre just too awesome. I love what youve got here, love what youre saying and the way you say it. You make it entertaining and you still manage to keep it smart. I cant wait to read more from you. This is really a great blog.

  70. I have recently started a blog, the info you provide on this website has helped me tremendously. Thank you for all of your time & work.

  71. webhosting disse:

    There is noticeably a lot of money to know about this particular. I assume you’ve made particular nice points in features additionally.

  72. I just want to tell you that I’m beginner to weblog and truly liked your blog. Likely I’m planning to bookmark your blog post . You actually come with incredible stories. Thank you for sharing your blog.

  73. I am continually looking online for articles that can aid me. Thank you!

  74. Chaki44 disse:

    I’d like to have more info on this subject, can I ask you the sources you used to write your post?

  75. You can definitely see your skills within the work you write. The sector hopes for even more passionate writers like you who are not afraid to mention how they believe. All the time go after your heart.

  76. I was reading through some of your blog posts on this site and I believe this website is very instructive! Continue posting .

  77. Sorry for the huge review, but I’m really loving the new Zune, and hope this, as well as the excellent reviews some other people have written, will help you decide if it’s the right choice for you.

  78. I definitely wanted to post a quick message to express gratitude to you for the splendid suggestions you are showing here. My prolonged internet search has at the end been rewarded with good quality content to write about with my best friends. I would suppose that most of us website visitors actually are very fortunate to be in a superb network with very many lovely individuals with very helpful principles. I feel very much privileged to have seen your webpage and look forward to really more excellent moments reading here. Thanks a lot once again for a lot of things.

  79. Vimax disse:

    Wow! Thank you! I constantly wanted to write on my blog something like that. Can I implement a fragment of your post to my blog?

  80. DavidB disse:

    I request more people would write sites like this that are as a matter of fact constructive to read. With all the fluff floating almost on the web, it is rare to look over a position like yours instead.

  81. There are definitely quite a lot of particulars like that to take into consideration. That could be a nice point to bring up. I offer the ideas above as general inspiration however clearly there are questions like the one you bring up the place the most important factor might be working in honest good faith. I don?t know if best practices have emerged round things like that, but I am sure that your job is clearly recognized as a good game. Both girls and boys feel the influence of just a moment’s pleasure, for the remainder of their lives.

  82. Chuck Toppi disse:

    When I initially commented I clicked the -Notify me when new feedback are added- checkbox and now each time a comment is added I get 4 emails with the identical comment. Is there any way you’ll be able to take away me from that service? Thanks!

Deixe uma resposta para Coconut Creek best chiropractorCancelar resposta

Contatos

hostiliocaio@hotmail.com

PUBLICIDADE

PUBLICIDADE

Busca no Blog

Arquivos

Arquivos

Arquivos